PNC-27 – Aliquot, 5mg
Apple Shopping Event
Hurry and get discounts up to 20% Read more
- Batch and lot coded with publicly visible lab reports to ensure quality and transparency.
- Less than 10% variance in concentration per lot, guaranteeing consistency.
- Formulated without corrosive agents for safety.
- Formulated with Acetate (counterion) instead of corrosive TFA for safety.
- Crimp-top glass aliquot to minimize degradation.
- Tamper-proof seal to ensure safety in transit.
$149.99
Authorities in our business will tell in no uncertain terms that Lorem Ipsum is that huge, huge no no to forswear forever. Not so fast, I'd say, there are some redeeming factors in favor of greeking text, as its use is merely the symptom of a worse problem to take into consideration.
Anyway, you still use Lorem Ipsum and rightly so, as it will always have a place in the web workers toolbox, as things happen, not always the way you like it, not always in the preferred order.
Product details
Made possible by exploring innovative molded plywood techniques, Iskos-Berlin’s Soft Edge Chair blends strong curves with extreme lightness to create a three-dimensionality not usually possible with 2-D plywood.
| Feature | Discountinued |
|---|---|
| Form | Aliquots |
| Types | Peptides |
Description
Data Sheet
PNC-27 – Aliquot, 5mg
| Application | Binds to HDM-2 |
| CAS | 1159861-00-3 |
| Molar Mass | 4031.72 g/mol |
| Chemical Formula | C188H293N53O44S |
| Amino Acid Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Synonyms | PNC-27, PNC27 |
| Storage | Store at ≤4°C, tightly sealed, away from heat, light and moisture. |
| Solubility | Soluble in BAC Water |
| Organoleptic Profile | White crystalline powder in 3mL glass aliquot |
| Composition | Each aliquot contains PNC-27, Acetate |
| Specification | PNC-27 content (per aliquot): PNC-27 5mg ±10% |
| Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering. |
Customer Reviews
Related Products
Online store with a wide selection of furniture and decor
Furniture is an invariable attribute of any room. It is they who give it the right atmosphere, making the space cozy and comfortable, creating favorable conditions for productive work or helping to relax after a hard day. More and more often, customers want to place an order in an online store, when you can sit down at the computer in your free time, arrange the furniture in the photo and calmly buy the furniture you like. The online store has a large catalog of furniture: both home and office furniture are available.
Furniture production is a modern form of art
Furniture manufacturers, as well as manufacturers of other home goods, are full of amazing offers: we often come across both standard mass-produced products and unique creations - furniture from professional craftsmen, which will be appreciated by true connoisseurs of beauty. We have selected for you the best models from modern craftsmen who managed to ingeniously combine elegance, quality and practicality in each product unit. Our assortment includes products from proven companies. Who for many years of continuous joint work did not give reason to doubt their reliability and honesty. All of them guarantee the high quality of their products, excellent operational characteristics, attractive appearance of the products, a long period of use of the furniture, as well as safety.
