N-Acetyl-Selank-Amidate – Spray, 10 mg

Apple Shopping Event

Hurry and get discounts up to 20% Read more

  • Batch and lot coded with publicly visible lab reports to ensure quality and transparency.
  • Less than 10% variance in concentration per lot, guaranteeing consistency.
  • Formulated without corrosive agents for safety.
  • Crimp-top glass aliquot to minimize degradation.
  • Tamper-proof seal to ensure safety in transit.

$112.49

Shipping and returns

Authorities in our business will tell in no uncertain terms that Lorem Ipsum is that huge, huge no no to forswear forever. Not so fast, I'd say, there are some redeeming factors in favor of greeking text, as its use is merely the symptom of a worse problem to take into consideration.

Product care

Anyway, you still use Lorem Ipsum and rightly so, as it will always have a place in the web workers toolbox, as things happen, not always the way you like it, not always in the preferred order.

Product details

Made possible by exploring innovative molded plywood techniques, Iskos-Berlin’s Soft Edge Chair blends strong curves with extreme lightness to create a three-dimensionality not usually possible with 2-D plywood.

FeatureDiscountinued
FormSprays
TypesPeptides

Description

Data Sheet

N-Acetyl-Selank-Amidate – Spray

Application Agonist of formyl peptide receptor like-1 (FPRL-1), purinergic receptor P2X7, epidermal growth factor receptor (EGFR) and insulin-like growth factor-1 receptor (IGF-1R)
CAS 154947-66-7
Molar Mass 4493 g/mol
Chemical Formula C205H340N60O53
Amino Acid Sequence [LL-37, 37 aa]
Synonyms CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536
Storage Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture
Solubility Soluble in BAC water
Organoleptic Profile Solid, white powder in 3mL glass aliquot
Composition Each aliquot contains LL-37
Specification LL-37 content for each variant (per aliquot):
LL-37 6mg ±10%
Terms This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.

Customer Reviews

Online store with a wide selection of furniture and decor

Furniture is an invariable attribute of any room. It is they who give it the right atmosphere, making the space cozy and comfortable, creating favorable conditions for productive work or helping to relax after a hard day. More and more often, customers want to place an order in an online store, when you can sit down at the computer in your free time, arrange the furniture in the photo and calmly buy the furniture you like. The online store has a large catalog of furniture: both home and office furniture are available.

Furniture production is a modern form of art

Furniture manufacturers, as well as manufacturers of other home goods, are full of amazing offers: we often come across both standard mass-produced products and unique creations - furniture from professional craftsmen, which will be appreciated by true connoisseurs of beauty. We have selected for you the best models from modern craftsmen who managed to ingeniously combine elegance, quality and practicality in each product unit. Our assortment includes products from proven companies. Who for many years of continuous joint work did not give reason to doubt their reliability and honesty. All of them guarantee the high quality of their products, excellent operational characteristics, attractive appearance of the products, a long period of use of the furniture, as well as safety.